Free Shipping on Orders $450+ | 5-Amino-1MQ 10% Off This Week
LL-37 is a human cathelicidin-derived host-defense peptide investigated across antimicrobial, biofilm, innate immune, inflammatory signaling, cellular migration, angiogenesis and tissue-repair research. This guide examines what LL-37 is, how it is generated, its molecular characteristics, major laboratory findings, and the limitations that researchers should understand when interpreting the literature.
LL-37 is a 37-amino-acid cationic peptide produced from the human cathelicidin precursor hCAP18, which is encoded by the CAMP gene. It is part of the innate host-defense system and has been studied for antimicrobial membrane interactions, biofilm regulation, immune-cell signaling, inflammatory modulation, cellular migration, angiogenesis and tissue-repair biology.
LL-37 structure, sequence, precursor biology, membrane interactions, antimicrobial and biofilm research, immunomodulatory signaling, wound-model research, angiogenesis, cancer biology, vitamin D regulation and important evidence limitations.
LL-37 belongs to the cathelicidin family of host-defense peptides. In humans, the CAMP gene encodes a larger precursor protein commonly called hCAP18. Proteolytic processing releases the C-terminal mature peptide LL-37. NCBI identifies CAMP as a protein-coding gene involved in antimicrobial activity, chemotaxis, immune mediator induction and inflammatory response regulation. [1]
The name is descriptive. The mature peptide begins with two leucine residues, represented by "LL", and contains 37 amino acids. LL-37 is therefore not simply a product code or arbitrary research name. It reflects the peptide's sequence and length.
LL-37 is expressed in several immune and epithelial contexts. Its biology is broader than direct antimicrobial activity, which is why modern literature often describes it as a host-defense peptide rather than only an antimicrobial peptide.
| Characteristic | Research Detail |
|---|---|
| Peptide | LL-37 |
| Peptide family | Human cathelicidin-derived host-defense peptide |
| Length | 37 amino acids |
| Gene | CAMP |
| Precursor | hCAP18 / cathelicidin antimicrobial peptide precursor |
| Experimental molecular mass | Approximately 4,492.9 Da, reported by UniProt |
| General structural character | Cationic, amphipathic, with alpha-helical structure under appropriate membrane-like conditions |
| Major research areas | Antimicrobial activity, biofilms, innate immunity, inflammatory signaling, chemotaxis, angiogenesis and tissue-repair biology |
UniProt reports an experimentally determined molecular mass of approximately 4,492.9 Da for mature LL-37. [2] The 37-residue sequence is:
LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTESStructural studies describe LL-37 as a flexible peptide whose conformation changes with its environment. In membrane-mimetic systems, much of the molecule can adopt an amphipathic alpha-helix, placing hydrophobic and charged residues on different faces of the structure. This arrangement is important because it allows LL-37 to interact with lipid membranes while remaining compatible with an aqueous environment. [3]
LL-37 does not have one universal mechanism. One of its most studied properties is its ability to associate with negatively charged microbial membranes. Its cationic character promotes electrostatic attraction, while hydrophobic portions of the peptide can interact with the lipid environment. Depending on the experimental system, this can destabilize membrane organization, increase permeability or contribute to pore-like membrane disruption.
Research also shows that LL-37 biology extends well beyond direct membrane damage. The peptide can interact with microbial products, extracellular nucleic acids and mammalian signaling systems. It has therefore been investigated as a multifunctional signaling molecule capable of influencing chemotaxis, cytokine responses, cell migration, survival and vascular biology. [4]
This pleiotropy is one reason simplified descriptions such as "LL-37 kills bacteria" do not capture the full research picture. Results vary according to organism, strain, peptide concentration, membrane environment, serum conditions and experimental design.
In vitro studies have investigated LL-37 against numerous Gram-positive and Gram-negative bacterial species, as well as selected fungi and enveloped viruses. Direct membrane interaction is a major component of this work, but antimicrobial susceptibility varies considerably among organisms.
Microbes can also resist or reduce LL-37 activity through mechanisms including membrane modification, altered surface charge, proteolytic degradation, extracellular structures and other adaptive responses. The 2021 literature review by Ridyard and Overhage emphasizes that resistance, peptide stability and activity under physiologically complex conditions remain important research challenges. [4]
Biofilm research is one of the most cited areas of LL-37 investigation. Biofilms are structured microbial communities embedded in an extracellular matrix, and their biology can differ substantially from free-living bacterial cultures.
A landmark 2008 study by Overhage and colleagues reported that LL-37 inhibited Pseudomonas aeruginosa biofilm formation in vitro at concentrations below those required to inhibit planktonic bacterial growth. The findings suggested that anti-biofilm effects could involve mechanisms distinct from straightforward bacterial killing. [5]
Later research has explored LL-37 and derived fragments against additional biofilm systems. However, results depend on the microbial species, maturity of the biofilm, assay design, concentration and environmental conditions. Prevention of biofilm formation should also be distinguished from disruption of an already established biofilm.
LL-37 is frequently described as a bridge between direct host defense and immune signaling. A landmark study published in 2000 found that LL-37 could act as a chemoattractant for human neutrophils, monocytes and T cells through the receptor then known as FPRL1, now commonly called FPR2. [6]
Other studies have linked LL-37 responses to additional signaling systems, including purinergic P2X7-related pathways in certain immune-cell models. For example, Barlow and colleagues reported cell-type-dependent effects of LL-37 on apoptotic pathways in primary innate immune cells. [7]
Importantly, LL-37 is not simply "pro-inflammatory" or "anti-inflammatory." Experimental studies have reported both types of responses. The direction of the effect can change with cell type, concentration, co-stimulus, receptor availability and surrounding inflammatory environment.
LL-37 has also been investigated in epithelial migration and wound-repair models. In a 2003 human skin study, Heilborn and colleagues observed increased LL-37 expression during normal wound repair and examined its relationship with re-epithelialization. [8]
Additional cell and animal experiments have examined keratinocyte migration, epithelial proliferation, vascularization and related repair processes. These findings have made LL-37 a recurring research target in skin biology and tissue-repair literature, but the strength and direction of an effect depend heavily on the specific model being studied.
Angiogenesis refers to the formation of new blood vessels from existing vascular structures. Koczulla and colleagues reported in 2003 that LL-37 stimulated endothelial-cell responses and angiogenesis in experimental models, with signaling linked to FPRL1/FPR2. [9]
This observation helped broaden LL-37 research beyond antimicrobial defense and into interactions among inflammation, vascular biology and tissue repair. These are mechanistic and preclinical findings and should not be interpreted as evidence for a clinical angiogenic application.
Regulation of the CAMP gene is another important part of LL-37 biology. Gombart, Borregaard and Koeffler demonstrated that the human CAMP gene can be directly regulated by the vitamin D receptor through a vitamin D response element in the gene's regulatory region. [10]
Their work also showed that this regulatory architecture differs across species, which is especially relevant when interpreting animal models. A mechanism observed in human cells cannot automatically be assumed to operate identically in mice or other laboratory species.
Cancer research provides one of the clearest examples of why LL-37 should not be reduced to a simple "beneficial" or "harmful" label. Published studies have reported different effects across tumor models. In some systems, elevated LL-37 signaling has been associated with cellular proliferation, migration, stromal recruitment or tumor-supportive signaling. Other experimental systems and LL-37-derived fragments have produced inhibitory or cytotoxic findings.
Reviews of the field therefore describe LL-37 activity as highly dependent on tumor type, receptor expression, peptide concentration and local microenvironment. [11]
| Research Area | What Has Been Investigated | Evidence Context |
|---|---|---|
| Antimicrobial activity | Membrane interaction and activity against multiple microbial species | Predominantly in vitro and mechanistic |
| Biofilms | Biofilm formation, microbial signaling and established biofilm susceptibility | Primarily in vitro |
| Chemotaxis | Migration of selected immune-cell populations and FPR2-related signaling | Cellular and mechanistic |
| Inflammatory signaling | Cytokine responses, microbial-product interactions and immune modulation | Cellular, mechanistic and observational |
| Tissue repair | Epithelial migration, re-epithelialization and wound-associated expression | Human tissue, cell and preclinical models |
| Angiogenesis | Endothelial activation, migration and vessel formation | Cell and animal models |
| Cancer biology | Proliferation, migration, apoptosis and microenvironment signaling | Highly model dependent, primarily experimental |
Researchers reviewing LL-37 for laboratory applications can view the current Luxara LL-37 peptide listing and supporting research-use information.
LL-37 is unusually sensitive to experimental context. Differences among published studies may reflect genuine biological complexity rather than simple disagreement.
These variables are especially important when comparing in vitro results with animal or human observations. A strong effect in a simplified laboratory system does not automatically predict the same effect in a more complex biological environment.
LL-37 research can be sensitive to material identity, purity, handling and storage. For that reason, researchers should evaluate a peptide as part of a broader documentation framework rather than relying on a product label alone.
Luxara Labs applies a 99%+ Purity standard across its research peptide catalog and maintains public resources covering third-party testing, COA interpretation, storage, transparency and research methodology. Batch-specific documentation should always be evaluated on its own terms.
Researchers can review the How to Read a COA guide, Peptide Testing & Transparency Hub, Peptide Storage, Handling & Stability guide and Research Standards & Methodology for additional context.
Peptide stability can be affected by temperature, moisture, light exposure and repeated temperature cycling. LL-37 research material should be maintained according to the product label and documented laboratory storage procedures. Researchers seeking general peptide stability information can refer to the Luxara storage guide linked above.
LL-37 is a 37-amino-acid human cathelicidin-derived host-defense peptide encoded through the CAMP precursor system. Its cationic, amphipathic molecular character supports interactions with microbial membranes, but the scientific literature shows that LL-37 biology extends substantially beyond direct antimicrobial activity.
Laboratory studies have investigated LL-37 in biofilm regulation, chemotaxis, immune signaling, inflammatory responses, epithelial migration, angiogenesis and tissue-repair biology. At the same time, antimicrobial resistance mechanisms, concentration-dependent effects, proteolysis, cell-type differences and environmental conditions can substantially change experimental outcomes.
The most scientifically accurate interpretation is therefore that LL-37 is a multifunctional research peptide whose effects are highly dependent on biological and experimental context. Mechanistic and preclinical findings should not be interpreted as established therapeutic outcomes.
View the Luxara LL-37 research listing or continue into Luxara's broader peptide research, documentation and quality resources.
LL-37 is a 37-amino-acid human cathelicidin-derived host-defense peptide produced from the hCAP18 precursor encoded by the CAMP gene. It is widely studied in antimicrobial, biofilm, immune signaling and tissue-biology research.
The name refers to the peptide's two N-terminal leucine residues, represented by "LL", and its total length of 37 amino acids.
Yes. LL-37 is a 37-residue peptide generated by proteolytic processing of the larger human cathelicidin precursor hCAP18.
Mature LL-37 contains 37 amino acids.
The mature human LL-37 sequence is [LL-37, 37 aa]
UniProt reports an experimentally determined molecular mass of approximately 4,492.9 Da for mature human LL-37.
hCAP18 is the larger human cathelicidin precursor protein. Proteolytic processing of its C-terminal region produces mature LL-37.
Laboratory studies have reported that LL-37 can influence biofilm formation in certain bacterial models, including effects observed at concentrations below those required for direct growth inhibition.
No. LL-37 has also been investigated in chemotaxis, inflammatory signaling, epithelial migration, angiogenesis, cell survival and other host-defense pathways.
Yes. Results can change with peptide concentration, cell type, microbial strain, membrane composition, ionic conditions, protease exposure and experimental model.
Research material should be stored according to the product label and documented laboratory handling procedures, with attention to temperature, moisture, light exposure and unnecessary temperature cycling.
No. Luxara LL-37 is supplied strictly for laboratory, analytical and educational research and is not intended for human or animal use.
Join our list and get an instant 10% discount code — valid for first-time buyers.