Free Shipping on Orders $450+ | 5-Amino-1MQ 10% Off This Week

Luxara Labs Research Guide

LL-37 Peptide Research Guide: Mechanism, Studies and Scientific Overview

LL-37 is a human cathelicidin-derived host-defense peptide investigated across antimicrobial, biofilm, innate immune, inflammatory signaling, cellular migration, angiogenesis and tissue-repair research. This guide examines what LL-37 is, how it is generated, its molecular characteristics, major laboratory findings, and the limitations that researchers should understand when interpreting the literature.

Updated August 17 2026 Scientific Research Guide By Luxara Labs Research Team
Research-use-only educational content. Luxara Labs materials are supplied strictly for laboratory, analytical and educational research and are not intended for human or animal use.
Direct Answer

What is LL-37?

LL-37 is a 37-amino-acid cationic peptide produced from the human cathelicidin precursor hCAP18, which is encoded by the CAMP gene. It is part of the innate host-defense system and has been studied for antimicrobial membrane interactions, biofilm regulation, immune-cell signaling, inflammatory modulation, cellular migration, angiogenesis and tissue-repair biology.

Guide Coverage

What this guide examines

LL-37 structure, sequence, precursor biology, membrane interactions, antimicrobial and biofilm research, immunomodulatory signaling, wound-model research, angiogenesis, cancer biology, vitamin D regulation and important evidence limitations.

Key Takeaways

LL-37 in brief

  • LL-37 is the mature 37-residue peptide derived from human hCAP18.
  • The peptide is cationic and can form amphipathic alpha-helical structures.
  • Membrane interaction is central to much of its antimicrobial research.
  • LL-37 also participates in signaling rather than acting only as a membrane-active peptide.
  • Biofilm, chemotaxis, angiogenesis and wound-biology findings are strongly model dependent.
  • LL-37 can produce different or even opposing effects depending on cell type and experimental conditions.

What Is LL-37 Peptide?

LL-37 belongs to the cathelicidin family of host-defense peptides. In humans, the CAMP gene encodes a larger precursor protein commonly called hCAP18. Proteolytic processing releases the C-terminal mature peptide LL-37. NCBI identifies CAMP as a protein-coding gene involved in antimicrobial activity, chemotaxis, immune mediator induction and inflammatory response regulation. [1]

The name is descriptive. The mature peptide begins with two leucine residues, represented by "LL", and contains 37 amino acids. LL-37 is therefore not simply a product code or arbitrary research name. It reflects the peptide's sequence and length.

LL-37 is expressed in several immune and epithelial contexts. Its biology is broader than direct antimicrobial activity, which is why modern literature often describes it as a host-defense peptide rather than only an antimicrobial peptide.

Characteristic Research Detail
Peptide LL-37
Peptide family Human cathelicidin-derived host-defense peptide
Length 37 amino acids
Gene CAMP
Precursor hCAP18 / cathelicidin antimicrobial peptide precursor
Experimental molecular mass Approximately 4,492.9 Da, reported by UniProt
General structural character Cationic, amphipathic, with alpha-helical structure under appropriate membrane-like conditions
Major research areas Antimicrobial activity, biofilms, innate immunity, inflammatory signaling, chemotaxis, angiogenesis and tissue-repair biology

LL-37 Structure, Sequence and Molecular Characteristics

UniProt reports an experimentally determined molecular mass of approximately 4,492.9 Da for mature LL-37. [2] The 37-residue sequence is:

LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES

Structural studies describe LL-37 as a flexible peptide whose conformation changes with its environment. In membrane-mimetic systems, much of the molecule can adopt an amphipathic alpha-helix, placing hydrophobic and charged residues on different faces of the structure. This arrangement is important because it allows LL-37 to interact with lipid membranes while remaining compatible with an aqueous environment. [3]

Why structure matters: LL-37 activity cannot be predicted from amino-acid sequence alone. Peptide concentration, membrane composition, ionic conditions, aggregation state and other molecules in the experimental system can alter its structure and observed activity.

How Does LL-37 Work in Laboratory Models?

LL-37 does not have one universal mechanism. One of its most studied properties is its ability to associate with negatively charged microbial membranes. Its cationic character promotes electrostatic attraction, while hydrophobic portions of the peptide can interact with the lipid environment. Depending on the experimental system, this can destabilize membrane organization, increase permeability or contribute to pore-like membrane disruption.

Research also shows that LL-37 biology extends well beyond direct membrane damage. The peptide can interact with microbial products, extracellular nucleic acids and mammalian signaling systems. It has therefore been investigated as a multifunctional signaling molecule capable of influencing chemotaxis, cytokine responses, cell migration, survival and vascular biology. [4]

This pleiotropy is one reason simplified descriptions such as "LL-37 kills bacteria" do not capture the full research picture. Results vary according to organism, strain, peptide concentration, membrane environment, serum conditions and experimental design.

LL-37 Antimicrobial Peptide Research

In vitro studies have investigated LL-37 against numerous Gram-positive and Gram-negative bacterial species, as well as selected fungi and enveloped viruses. Direct membrane interaction is a major component of this work, but antimicrobial susceptibility varies considerably among organisms.

Microbes can also resist or reduce LL-37 activity through mechanisms including membrane modification, altered surface charge, proteolytic degradation, extracellular structures and other adaptive responses. The 2021 literature review by Ridyard and Overhage emphasizes that resistance, peptide stability and activity under physiologically complex conditions remain important research challenges. [4]

Evidence context: Demonstrating antimicrobial activity in a controlled assay does not establish LL-37 as an approved antimicrobial medicine. Laboratory activity, biological function and clinical effectiveness are separate questions.

LL-37 and Biofilm Research

Biofilm research is one of the most cited areas of LL-37 investigation. Biofilms are structured microbial communities embedded in an extracellular matrix, and their biology can differ substantially from free-living bacterial cultures.

A landmark 2008 study by Overhage and colleagues reported that LL-37 inhibited Pseudomonas aeruginosa biofilm formation in vitro at concentrations below those required to inhibit planktonic bacterial growth. The findings suggested that anti-biofilm effects could involve mechanisms distinct from straightforward bacterial killing. [5]

Later research has explored LL-37 and derived fragments against additional biofilm systems. However, results depend on the microbial species, maturity of the biofilm, assay design, concentration and environmental conditions. Prevention of biofilm formation should also be distinguished from disruption of an already established biofilm.

LL-37, Innate Immunity and Immune Signaling

LL-37 is frequently described as a bridge between direct host defense and immune signaling. A landmark study published in 2000 found that LL-37 could act as a chemoattractant for human neutrophils, monocytes and T cells through the receptor then known as FPRL1, now commonly called FPR2. [6]

Other studies have linked LL-37 responses to additional signaling systems, including purinergic P2X7-related pathways in certain immune-cell models. For example, Barlow and colleagues reported cell-type-dependent effects of LL-37 on apoptotic pathways in primary innate immune cells. [7]

Importantly, LL-37 is not simply "pro-inflammatory" or "anti-inflammatory." Experimental studies have reported both types of responses. The direction of the effect can change with cell type, concentration, co-stimulus, receptor availability and surrounding inflammatory environment.

Cell Migration, Tissue Repair and Wound-Biology Research

LL-37 has also been investigated in epithelial migration and wound-repair models. In a 2003 human skin study, Heilborn and colleagues observed increased LL-37 expression during normal wound repair and examined its relationship with re-epithelialization. [8]

Additional cell and animal experiments have examined keratinocyte migration, epithelial proliferation, vascularization and related repair processes. These findings have made LL-37 a recurring research target in skin biology and tissue-repair literature, but the strength and direction of an effect depend heavily on the specific model being studied.

LL-37 and Angiogenesis Research

Angiogenesis refers to the formation of new blood vessels from existing vascular structures. Koczulla and colleagues reported in 2003 that LL-37 stimulated endothelial-cell responses and angiogenesis in experimental models, with signaling linked to FPRL1/FPR2. [9]

This observation helped broaden LL-37 research beyond antimicrobial defense and into interactions among inflammation, vascular biology and tissue repair. These are mechanistic and preclinical findings and should not be interpreted as evidence for a clinical angiogenic application.

LL-37, CAMP Expression and Vitamin D Research

Regulation of the CAMP gene is another important part of LL-37 biology. Gombart, Borregaard and Koeffler demonstrated that the human CAMP gene can be directly regulated by the vitamin D receptor through a vitamin D response element in the gene's regulatory region. [10]

Their work also showed that this regulatory architecture differs across species, which is especially relevant when interpreting animal models. A mechanism observed in human cells cannot automatically be assumed to operate identically in mice or other laboratory species.

LL-37 in Cancer Research: Why the Findings Are Context Dependent

Cancer research provides one of the clearest examples of why LL-37 should not be reduced to a simple "beneficial" or "harmful" label. Published studies have reported different effects across tumor models. In some systems, elevated LL-37 signaling has been associated with cellular proliferation, migration, stromal recruitment or tumor-supportive signaling. Other experimental systems and LL-37-derived fragments have produced inhibitory or cytotoxic findings.

Reviews of the field therefore describe LL-37 activity as highly dependent on tumor type, receptor expression, peptide concentration and local microenvironment. [11]

Research interpretation: Opposing findings across cancer models are not necessarily contradictory. They may reflect different cell types, receptors, concentrations and experimental conditions. This is a major reason mechanistic findings should not be extrapolated into therapeutic conclusions.

LL-37 Research Areas and Evidence Context

Research Area What Has Been Investigated Evidence Context
Antimicrobial activity Membrane interaction and activity against multiple microbial species Predominantly in vitro and mechanistic
Biofilms Biofilm formation, microbial signaling and established biofilm susceptibility Primarily in vitro
Chemotaxis Migration of selected immune-cell populations and FPR2-related signaling Cellular and mechanistic
Inflammatory signaling Cytokine responses, microbial-product interactions and immune modulation Cellular, mechanistic and observational
Tissue repair Epithelial migration, re-epithelialization and wound-associated expression Human tissue, cell and preclinical models
Angiogenesis Endothelial activation, migration and vessel formation Cell and animal models
Cancer biology Proliferation, migration, apoptosis and microenvironment signaling Highly model dependent, primarily experimental
Laboratory Research Material

Explore LL-37 Peptide

Researchers reviewing LL-37 for laboratory applications can view the current Luxara LL-37 peptide listing and supporting research-use information.

Why LL-37 Research Findings Can Differ

LL-37 is unusually sensitive to experimental context. Differences among published studies may reflect genuine biological complexity rather than simple disagreement.

  • Concentration: signaling, antimicrobial and cytotoxic effects may occur across different concentration ranges.
  • Ionic environment: salts and surrounding molecules can change electrostatic peptide-membrane interactions.
  • Serum and proteins: binding to proteins or lipids can alter the amount of freely available peptide.
  • Proteolysis: LL-37 can be degraded or processed by proteases.
  • Cell type: receptor expression and signaling machinery differ among cells.
  • Microbial strain: susceptibility and resistance mechanisms vary widely.
  • Model selection: purified membranes, cultured cells, animals and human tissue answer different biological questions.

These variables are especially important when comparing in vitro results with animal or human observations. A strong effect in a simplified laboratory system does not automatically predict the same effect in a more complex biological environment.

Research Material Quality, Testing and Documentation

LL-37 research can be sensitive to material identity, purity, handling and storage. For that reason, researchers should evaluate a peptide as part of a broader documentation framework rather than relying on a product label alone.

Luxara Labs applies a 99%+ Purity standard across its research peptide catalog and maintains public resources covering third-party testing, COA interpretation, storage, transparency and research methodology. Batch-specific documentation should always be evaluated on its own terms.

Researchers can review the How to Read a COA guide, Peptide Testing & Transparency Hub, Peptide Storage, Handling & Stability guide and Research Standards & Methodology for additional context.

Storage and handling context

Peptide stability can be affected by temperature, moisture, light exposure and repeated temperature cycling. LL-37 research material should be maintained according to the product label and documented laboratory storage procedures. Researchers seeking general peptide stability information can refer to the Luxara storage guide linked above.

Research Summary

LL-37 is a 37-amino-acid human cathelicidin-derived host-defense peptide encoded through the CAMP precursor system. Its cationic, amphipathic molecular character supports interactions with microbial membranes, but the scientific literature shows that LL-37 biology extends substantially beyond direct antimicrobial activity.

Laboratory studies have investigated LL-37 in biofilm regulation, chemotaxis, immune signaling, inflammatory responses, epithelial migration, angiogenesis and tissue-repair biology. At the same time, antimicrobial resistance mechanisms, concentration-dependent effects, proteolysis, cell-type differences and environmental conditions can substantially change experimental outcomes.

The most scientifically accurate interpretation is therefore that LL-37 is a multifunctional research peptide whose effects are highly dependent on biological and experimental context. Mechanistic and preclinical findings should not be interpreted as established therapeutic outcomes.

Luxara Labs

LL-37 Research Material and Supporting Documentation

View the Luxara LL-37 research listing or continue into Luxara's broader peptide research, documentation and quality resources.

Frequently Asked Questions About LL-37

What is LL-37?

LL-37 is a 37-amino-acid human cathelicidin-derived host-defense peptide produced from the hCAP18 precursor encoded by the CAMP gene. It is widely studied in antimicrobial, biofilm, immune signaling and tissue-biology research.

What does LL-37 stand for?

The name refers to the peptide's two N-terminal leucine residues, represented by "LL", and its total length of 37 amino acids.

Is LL-37 a peptide?

Yes. LL-37 is a 37-residue peptide generated by proteolytic processing of the larger human cathelicidin precursor hCAP18.

How many amino acids are in LL-37?

Mature LL-37 contains 37 amino acids.

What is the LL-37 amino-acid sequence?

The mature human LL-37 sequence is LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES.

What is the molecular weight of LL-37?

UniProt reports an experimentally determined molecular mass of approximately 4,492.9 Da for mature human LL-37.

What is the relationship between LL-37 and hCAP18?

hCAP18 is the larger human cathelicidin precursor protein. Proteolytic processing of its C-terminal region produces mature LL-37.

Why is LL-37 studied in biofilm research?

Laboratory studies have reported that LL-37 can influence biofilm formation in certain bacterial models, including effects observed at concentrations below those required for direct growth inhibition.

Does LL-37 only have antimicrobial activity?

No. LL-37 has also been investigated in chemotaxis, inflammatory signaling, epithelial migration, angiogenesis, cell survival and other host-defense pathways.

Is LL-37 research context dependent?

Yes. Results can change with peptide concentration, cell type, microbial strain, membrane composition, ionic conditions, protease exposure and experimental model.

How should LL-37 research material be stored?

Research material should be stored according to the product label and documented laboratory handling procedures, with attention to temperature, moisture, light exposure and unnecessary temperature cycling.

Is Luxara LL-37 intended for human or animal use?

No. Luxara LL-37 is supplied strictly for laboratory, analytical and educational research and is not intended for human or animal use.

Selected Scientific References

  1. NCBI Gene. CAMP cathelicidin antimicrobial peptide, Homo sapiens. NCBI Gene 820.
  2. UniProt. Cathelicidin antimicrobial peptide, CAMP_HUMAN, P49913. UniProt P49913.
  3. Bhattacharjya S. LL-37: Structures, Antimicrobial Activity, and Influence on Cell Processes. 2024. PubMed.
  4. Ridyard KE, Overhage J. The Potential of Human Peptide LL-37 as an Antimicrobial and Anti-Biofilm Agent. 2021. PubMed Central.
  5. Overhage J, Campisano A, Bains M, Torfs ECW, Rehm BHA, Hancock REW. Human Host Defense Peptide LL-37 Prevents Bacterial Biofilm Formation. Infect Immun. 2008. PubMed.
  6. Yang D, Chertov O, Oppenheim JJ. LL-37 utilizes formyl peptide receptor-like 1 to chemoattract human peripheral blood neutrophils, monocytes and T cells. J Exp Med. 2000. PubMed.
  7. Barlow PG et al. The human cationic host defense peptide LL-37 mediates contrasting effects on apoptotic pathways in different primary cells of the innate immune system. 2006. PubMed.
  8. Heilborn JD et al. The cathelicidin antimicrobial peptide LL-37 is involved in re-epithelialization of human skin wounds. J Invest Dermatol. 2003. PubMed.
  9. Koczulla R et al. An angiogenic role for the human peptide antibiotic LL-37/hCAP-18. J Clin Invest. 2003. PubMed.
  10. Gombart AF, Borregaard N, Koeffler HP. Human cathelicidin antimicrobial peptide CAMP gene is a direct target of the vitamin D receptor. FASEB J. 2005. PubMed.
  11. Piktel E et al. The Role of Cathelicidin LL-37 in Cancer Development. 2016. PubMed Central.

Unlock 10% Off Your First Order

Join our list and get an instant 10% discount code — valid for first-time buyers.

10% Popup Email Opt-in